PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ48881.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family GATA
Protein Properties Length: 294aa    MW: 30071.5 Da    PI: 8.392
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ48881.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA53.53.2e-17229259131
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyr 31 
                 C  Cg+t+Tp+WR+gp g+ktLCnaCG++y 
  KXZ48881.1 229 CMECGATSTPQWREGPAGPKTLCNACGVRYV 259
                 999**************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS510389.32198IPR001025Bromo adjacent homology (BAH) domain
SuperFamilySSF577163.9E-13220261No hitNo description
SMARTSM004012.2E-11223274IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.809223258IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.4E-14226262IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.01E-10228258No hitNo description
PfamPF003201.4E-14229258IPR000679Zinc finger, GATA-type
PROSITE patternPS003440229254IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MSLQLFVWVG QGKVKWFERR VNLEPSTKGI EESEREVFEL EDTDVNPIGK SCGCISGKCR  60
IVKAHNYEEA FNQYGSAAGW FFCRGYFQQS TNSFVAYTPT EMASRDGAPP DGLLPHPAAA  120
GLGAGAGAAA DGALLPAHPG GAAAVAVAPQ RLAAGMGGGV QALDALGRGG LPPGAGGYSN  180
GDVLGADEEP EAPPAHPRGR GPGSAAGSNP PPSQQQPASK RQKATGRTCM ECGATSTPQW  240
REGPAGPKTL CNACGVRYVR SQQKAAGQKR SSGGAKNGQG RLQGSPNAPS GSAE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A150GGB40.0A0A150GGB4_GONPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2201430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.12e-13GATA transcription factor 1